JOURNAL OF INDEPENDENT MEDICAL RESEARCH

COLLABORATIVE PUBLISHING FOR THE 21stCENTURY


HOME        Peer Review These Papers        Papers Sent To PubMed        Peer Review Rules        Advisory Board        Contact Us


 Go back to Main Menu  |  SEARCH  |  Log In    
 SNARES, Antigens, Retroviruses, Superantigens, and Schizophrenia
Author: Robert Lee (---.ventca.adelphia.net)
Date:   10-26-05 19:28

SNARES, Antigens, Retroviruses, Superantigens, and Schizophrenia


Author: Robert E. Lee, M.S., M.S.W., L.C.S.W., Ph.D.
Contact Email: wolfpsy @NOSPAM@ hotmail.com

Received: 26 August 2005
Revised: 22 October 2005
Date Published: 23 October 2005

Please cite as:
Lee RE: SNARES, Antigens, Retroviruses, Superantigens, and Schizophrenia. JOIMR 2005;3(1):1


Abstract

SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) are central components of the machinery mediating membrane fusion in all eukaryotic cells. Sets of SNARE proteins mediate membrane fusion by assembling into core complexes.  SNAREs are cytoplasmically oriented membrane proteins that reside on vesicular carriers (v-SNARE) and target organelles (t-SNARE). The pairing of a stage-specific v-SNARE with its cognate t-SNARE may mediate the specificity of membrane traffic. This paper presents evidence that a retrovirus syntaxin-17-like SNARE may be important in understanding genesis of some schizophrenias.



Introduction
Multiple SNAREs are thought to function in different intracellular trafficking steps but it is often unclear which of the SNAREs cooperate in individual fusion reactions.  For example, insulin recruits glucose transporter 4 (GLUT-4) vesicles from intracellular stores to the plasma membrane in muscle and adipose tissue by specific interactions between the vesicle membrane-soluble N-ethylmaleimide-sensitive factor attachment protein target receptor (v-SNARE) protein VAMP-2 and the target membrane SNARE protein syntaxin 4 (t-SNARE).  Precisely how fusion occurs remains unclear but this example reveals that SNAREs do mediate membrane fusion. Work by Watson and Pessin (2001) support a model in SNARE mediation of membrane fusion wherein short transmembrane domains ( <= 17 amino acids) direct the cis-Golgi localization of syntaxins, whereas long transmembrane domains ( >=23 amino acids) direct plasma membrane localization[1].

The endoplasmic reticulum (ER) is the largest continuous endomembrane structure in the cytoplasm. It may be viewed as a series of unique subcompartments. Syntaxins are a family of vesicular transport receptors that are involved in membrane traffic through both the constitutive and regulated secretory pathways and are SNARE proteins.  Dascher, Matteson & Balch (1994) reported syntaxin 5 has a role in regulating the potential targeting and/or fusion of carrier vesicles following export from the ER. [2]  Others have found SNAREs that regulate traffic from the endoplasmic reticulum to the Golgi apparatus [3]. Nichols and Pelham reported:
Soluble factors, NSF and SNAPs, are required at many membrane fusion events within the cell. They interact with a class of type II integral membrane proteins termed SNAP receptors, or SNAREs. Interaction between cognate SNAREs on opposing membranes is a prerequisite for NSF dependent membrane fusion. NSF is an ATPase which will disrupt complexes composed of different SNAREs. However, there is increasingly abundant evidence that the SNARE complex recognised by NSF does not bridge the two fusing membranes, but rather is composed of SNAREs in the same membrane. The essential role of NSF may be to prime SNAREs for a direct role during fusion.

And continued with:
We suggest that these observations are most compatible with a model for transit through the Golgi in which anterograde cargo is carried in cisternae, the enzymatic composition of which changes with time as Golgi resident enzymes are delivered in retrograde transport vesicles [4].

Xu, Joglekar, Williams, & Hay (2000) provided an excellent discussion regarding the subunit structure of a mammalian ER/Golgi SNARE complex and described the subunit structure, assembly, and regulation of a quaternary SNARE complex, which appears to mediate an early step in endoplasmic reticulum (ER) to Golgi transport [5]. Steegmaier, Oorschot, Klumperman, & Scheller (2000) reported that Syntaxin-17 is abundantly expressed in steroidogenic cell types and specifically localizes to smooth membranes of the ER. By immunoprecipitation analyses, Syntaxin-17 exists in complexes with a syntaxin regulatory protein, rsly1, and/or two intermediate
compartment SNARE proteins, rsec22b and rbet1.  They added, [I]"we found that Syntaxin-17 is anchored to the smooth endoplasmic reticulum through an unusual mechanism, requiring two adjacent hydrophobic domains near its carboxyl terminus. Converging lines of evidence indicate that Syntaxin-17 functions in a vesicle-trafficking step to the smooth-surfaced tubular ER membranes that are abundant in steroidogenic cells [6]."[/I]

Syntaxin-17 (STX17) is a divergent member of the syntaxin family of proteins first discovered by Scheller and colleagues in a yeast two-hybrid screen designed to identify novel mammalian SNAREs (soluble N-ethylmaleimide-sensitive factor-attachment protein receptors). Zhang, Li, Deavers, Abbruzzese, and Ho (2005), [7] stated:
We recently independently identified STX17 as a novel Ras-interacting protein, but immunohistochemical studies suggested that STX17 is localized to the nucleus in normal pancreatic ductal pithelial, acinar, and islet cells in contrast to previous reports of cytoplasmic localization, albeit in other cell types. Therefore, we have conducted a more thorough survey of various human and mouse tissues to better establish the expression pattern of STX17 in different tissues and cell types. Although RT-PCR experiments demonstrate ubiquitous expression of STX17, closer examination by immunohistochemistry reveal that STX17 expression is limited to certain cell types. Furthermore, in contrast to the cytoplasmic localization previously reported in a limited number of cell types, we find that in many other cell types, Syntaxin-17 can be found in the nucleus. Finally, we demonstrate that in human hepatocellular carcinoma cell lines, STX17 localization is altered relative to normal hepatocytes although the localization of STX17 differs even between these established human cancer cell lines and fresh human hepatocellular carcinoma cells, emphasizing the caution that must be exercised in drawing conclusions from data gathered in cell lines. The sequence divergence of STX17, the unexpected nuclear localization of STX17 in many cell types, and the altered localization of STX17 in malignant cells argue for a novel function of Syntaxin-17 distinct from its hypothesized role in mediating membrane fusion events.

Honer et al. (2002) reported that abnormalities of SNARE mechanism proteins exist in anterior frontal cortex in severe mental illness. The team stated:
A fundamental molecular component of neural connectivity is the SNARE (SNAP receptor) protein complex, which consists of three proteins, syntaxin, SNAP-25 and VAMP. Under appropriate conditions, the SNARE complex can be formed in vitro. To investigate the hypothesis that dysregulation of SNARE proteins or their interactions could be abnormal in severe mental disorders, the three SNARE proteins and the complex were studied in post-mortem anterior frontal cortex homogenates. An ELISA was used to quantify SNARE protein immunoreactivities in cortical homogenates from four groups: patients with schizophrenia who died of causes other than suicide (n = 6), patients with schizophrenia and suicide (n = 7), patients with depression and suicide (n = 11), and controls (n = 11). Differences between groups in patterns of SNARE protein immuno-reactivities were demonstrated [Wilks' Lambda F(9,68) = 3.57, P = 0.001]. Protein-by-protein analyses indicated a significant reduction in SNAP-25 immunoreactivity in the schizophrenia non-suicide group [28 decrease relative to controls, F(3,31) = 6.45, P = 0.002, Student-Newman-Keuls test, P < 0.01]. The intercorrelations between SNARE protein and synaptophysin immunoreactivities were high in controls, but lower in the other groups, further indicating disturbances in relationships between these proteins. The extent of SNARE complex formation in vitro was studied using immuno-blotting. Significant differences related to group membership were observed for the SNARE complexes identified by SNAP-25 [Wilks' Lambda F(3,31)=4.76, P=0.008] and by syntaxin immunostaining [Wilks' Lambda F(3,31)=9.16, P=0.0002]. In both groups with suicide as a cause of death, relatively more SNAP-25 and syntaxin was present in the heterotrimeric SNARE complex than in other molecular forms. These abnormalities in the SNARE complex could represent a molecular substrate for abnormalities of neural connectivity in severe mental disorders [8].

Wong et al. (2004) indicated an association between schizophrenia and the syntaxin 1A gene. This team stated:
Genetic association between polymorphic markers in the syntaxin 1A gene and schizophrenia was assessed in a matched case-control sample of 192 pairs, and in an independent sample of 238 nuclear families. RESULTS: In the family-based sample, a significant genetic association was found between schizophrenia and one of the four single nucleotide polymorphisms (SNPs) tested: an intron 7 SNP (transmission disequilibrium test [TDT] chi(2)=5.898; df=1; p=.015, family-based association test [FBAT] z=2.280, p=.023). When the results for the TDT and case-control analyses were combined, the association was stronger (n=430; z(c)=2.859; p=.004). Haplotype analysis supported the association with several significant values that appear to be driven by the intron 7 SNP [9].


Syntaxins and Viruses
Steegmaier et al. (2000) reported Syntaxin-17 is abundantly expressed in steroidogenic cell types and specifically localizes to smooth membranes of the ER and that Syntaxin-17 functions in a vesicle-trafficking step to the smooth-surfaced tubular ER membranes that are abundant in steroidogenic cells [10].

Consider the following alignment of 1MOF (Moloney Murine Leukemia Virus p15e spike) to a Syntaxin-17 homologue:

gi|21430542|gb|AAM50949.1|     RYANGLRYFNSALDLNPFNERALMRRSQLKRSMGLASEALKDCSRAEDLL 100
gi|23170569|gb|AAF54019.2|     RYANGLRYFNSALDLNPFNERALMRRSQLKRSMGLASEALKDCSRAEDLL 100
gi|1827626|pdb|1MOF|           --MDDLREVEKSIS-------------NLEKSLTSLSEVVLQNRRGLDLL 35
                                  :.** .:.::.             :*::*:   **.: :  *. ***

gi|21430542|gb|AAM50949.1|     MSRKPPVTNPNVSLEVCDALYESNRLEDSKINLHCHLKRFSSGQRGPVLD 150
gi|23170569|gb|AAF54019.2|     MSRKPPVTNPNVSLEVCDALYESNRLEDSKINLHCHLKRFSSGQRGPVLD 150
gi|1827626|pdb|1MOF|           FLKEG---------GLCAALKE-----------ECAF--YAD-------- 55
                               : ::           :* ** *           .* :  ::.        


Particularly notice immediately above the aligned portion of 1MOF that is this:
NLEKSLTSLSEVVLQNRRGLDLL

A blast of this sequence shows that the sequence is found in the Friend-Moloney-Rauscher (FMR) group of murine leukemia virus envelopes in the p15e spike protein of these murine leukemia Type-C retroviruses. Graphic rendition of the portion of Syntaxin-17 homologue which aligns with 1MOF shows this image:



As can be seen in the above image, the yellow-highlighted amino acids of Syntaxin-17 homologue which align with 1MOF are surface and part of the long chain making up p15e.

SZRV/HERV-W is a retrovirus that has been found present in some individuals with schizophrenia. Deb-Rinker (1999) stated:
"Retroviral-related amplicons were used in modified RDA to identify four sequences from affected members of three pairs of monozygotic twins discordant for schizophrenia. One sequence (schizophrenia associated retrovirus, SZRV-1, GenBank Accession No. AF135487) is characterized here. It is similar to two known sequences of retroviral origin: multiple sclerosis-associated retrovirus, MSRV (GenBank Accession No. AF009668), and ERV-9 (GenBank Accession No. S77575)." [11]

The envelope of MSRV is Accession No. AAK18189.1 at PubMed and is referred to in this present article from time-to-time as SZRV. Multiple sequence alignment of the pol of SZRV-1 (Accession No. AF135487) that has been translated from DNA to amino acid structure and MSRV align nearly perfectly. It is reasonable to conclude that the two are, if not the same virus, essentially the same virus.

Now consider this alignment:

gi|47605612|sp|P61561|ENW1_GOR     SQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGTCLFL 400
gi|13310191|gb|AAK18189.1|AF33     SQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFL 400
gi|1827626|pdb|1MOF|               ----MDDLREVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAAL 46
                                        .*:..* .*: .*:..*.**: *******.****  :.** *  *

gi|47605612|sp|P61561|ENW1_GOR     GEECCYYVNQSGIVTEKVKEIRDRIQRRAEELRNTGPWGLLSQWMPWILP 450
gi|13310191|gb|AAK18189.1|AF33     GEERCYYVNQSRIVTEKVKEIRDRIQCRAEELQNTERWGLLSQWMPWTLP 450
gi|1827626|pdb|1MOF|               KEECAFYAD----------------------------------------- 55
                                    ** .:*.:


The above alignment is of 1MOF and SZRV/HERV-W envelope in the region of p15e spike protein. Here is a graphic image of 1MOF with the aligning amino acids of SZRV/HERV-W highlighted in yellow:



Placing the two images side by side, we see this:



To the left, above, is 1MOF with aligning bits of Syntaxin-17 homologue highlighted; to the right is 1MOF with aligning bits of SZRV/HERV-W envelope highlighted. Very much the same structure is seen highlighted in yellow between Syntaxin-17 homologue and SZRV/HERV-W as indexed by 1MOF. SZRV/HERV-W envelope appears to show the same pattern as Syntaxin-17 homologue but SZRV/HERV-W envelope has more homology to 1MOF in the identified region.

Considering whether this identified region is important, consider this alignment:

gi|54639516|gb|EAL28918.1|         LGLARINEYKIPSDMTVLKGKQRLLTLFGLPHEMNINALKENPK------ 368
gi|13310191|gb|AAK18189.1|AF33     SQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFL 400
                                       . :  ::...:..*:.: . *: . * :.  :: *. : 


The region of AAK18189.1, which is SZRV/HERV-W envelope, aligns well in motif to EAL28918.1, which is a Drosophila obscura gene product resembling Syntaxin-17, at this region in EAL28918.1:

LKGKQRLLTLFGLPHEMNINAL

The region appears also to resemble glucose-6-phosphate dehydrogenase as well as NADH dehydrogenase. Camardella et al. (1995) reported:
Human erythrocytes contain a nicotinamide adenine dinucleotide phosphate (NADP[H])-binding protein, FX, whose levels are significantly increased in erythrocytes from glucose-6-phosphate dehydrogenase (G6PD)-deficient individuals bearing the mediterranean variant of G6PD. Elucidation of the still unknown biologic functions of FX was approached by means of amino acid sequencing of its 25 tryptic peptides. Searching in the EMBL data bank allowed identification of extensive homology between these tryptic peptides and all sequence-aligned regions encompassing the complete structure of a putative protein encoded by the P35B gene in the mouse. This gene, which differs from the normal allele by a point mutation, has been previously cloned from a tum- variant of the murine tumor cell line P815, so defined because it is associated with low tumorigenicity compared with the progenitor P815." [12]

The alignment with SZRV/HERV-W to P35B is:

gi|4507709|ref|NP_003304.1|        MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDAD--L 48
gi|1683411|gb|AH004674.1|          ---------ILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDAD--L 39
gi|13310191|gb|AAK18189.1|AF33     ------------------MEQVTDSLVTLQDQLNSLAAVVLQNRRALDLL 32
                                                     : :. :.:*:    * .   *.:..: *   *

gi|4507709|ref|NP_003304.1|        TDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVL 98
gi|1683411|gb|AH004674.1|          TDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVL 89
gi|13310191|gb|AAK18189.1|AF33     TAKRGGTCLFLGEERCYYVNQSRIVTEKVKEIRDRIQCRAEELQN----- 77
                                   * .    .**   :  : :: : :*   .::*: .::   :::: 


The above alignment of P35B and SZRV/HERV-W appears to look somewhat similar to the structure of Syntaxin-17.

The alignment of P815 with SZRV/HERV-W is:

gi|13310191|gb|AAK18189.1|AF33     SQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFL 400
gi|285053|pir||PC1154              AQKISDDLMQKIST----------------QNRRALDLVAAK-------- 26
                                   :*:*..*: *  .:                ********::** 

gi|13310191|gb|AAK18189.1|AF33     GEERCYYVNQSRIVTEKVKEIRDRIQCRAEELQNTERWGLLSQWMPWTLP 450
gi|285053|pir||PC1154              ----CYYYH------ARVYEFLD--------------------------- 39
                                       *** :       :* *: * 

gi|13310191|gb|AAK18189.1|AF33     SQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFL 400
gi|285053|pir||PC1154              ---------------------------------KLDVVR----------- 45
                                                                    **::* 


Clearly there is a remarkable degree of homology in the identified regions of the two proteins (P815 and SZRV/HERV-W env) above. Data suggest a relationship to Syntaxin-17 as well. In the alignment immediately above of P815 with SZRV/HERV-W this sequence:

LVTLQDQLNSLAAVVL

that is in the gap of P815 appears to resemble syntaxin. Bared et al. (2004) has discussed homologues of the above protein in relationship to syntaxins. [13] as has Siddiqi et al. (2003) in relationship to homologues of the above sequence being "cargo proteins" involved in syntaxin activity. [14] A multiple sequence alignment helps to elucidate LVTLQDQLNSLAAVVL:

gi|285053|pir||PC1154              AQKISDDLMQKIST----------------QNRRALDLVAAK-------- 26
gi|13310191|gb|AAK18189.1|AF33     SQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFL 400
gi|33357304|pdb|1LS4|A             ARNLNNSIHDAATSLN------------LQDQLNSLQSALTNVG------ 128
gi|37595266|gb|AAQ94518.1|         RQGLSRDLEASREAKK--------------KVEADLAALTAE-------- 202
                                    : :. .:     :                .    *    ::  


Examine the above alignment and attend to the red and blue highlighted portions. Strangely they do no align yet show this sameness:

LQDQLNSLAAVVL
LQDQLNSLQSALTNVG
********


1LS4 is Chain A, Nmr Structure Of Apolipophorin-III From Locusta Migratoria. Apolipophorin III (apoLp-III) is a low molecular weight exchangeable apolipoprotein that plays an important role in the enhanced neutral lipid transport. apoLp-III can also serve as an immune activator. Park et al. (2005) reported apoLp-III is involved in the activation of the prophenoloxidase (PPO) cascade, which has been regarded as a critical immune reaction in insect hemolymph. [15] Ji et al. (2004) reported a serine proteinase cascade in insect hemolymph mediates prophenoloxidase activation, a defense mechanism against pathogen or parasite infection. [16] The identified section of SZRV appears a serine-threonine receptor. Lai et al. (2005) reported prophenoloxidase activation system in haemocytes of the white shrimp Litopenaeus vannamei serves an important function in non-self recognition and host immune reactions[17].

As indicated above, Camardella (1995) reported human erythrocytes contain a nicotinamide adenine dinucleotide phosphate (NADP[H])-binding protein, FX, whose levels are significantly increased in erythrocytes from glucose-6-phosphate dehydrogenase (G6PD)-deficient individuals bearing the mediterranean variant of G6PD. Human FX protein, mentioned above, has been indicated, by Tonetti et al. (1996), as
"the enzyme responsible for the last step of the major metabolic pathway resulting in GDP-L-fucose synthesis from GDP-D-mannose in procaryotic and eucaryotic cells. Specifically, purified FX apparently catalyzes a combined epimerase and NADPH-dependent reductase reaction, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. This is the substrate of several fucosyltranferases involved in the correct expression of many glyconjugates, including blood groups and developmental antigens." [18]

FX protein in its comparable region to SZRV/HERV-W has a rather similar protein:

LFIWVLREYNEVEPIILS

which shows relationship in blast to be similar to tissue specific transplantation antigen P35B, nicotinamide adenine dinucleotide phosphate (NADP[H])-binding protein FX, MHC class I tum- transplantation antigen, and GDP-D-mannose.

G6PD-deficiency has been long considered related to psychiatric disorders. Bocchetta (2003) reported,
"A relationship between psychiatric disorder and G6PD deficiency is to be searched in the bipolar spectrum, particularly among patients with a history of acute episodes with psychotic and/or catatonic symptoms or with transient confusion." [19]

The progenitor P91A tum peptide has QNRRALDL in its structure just as has SZRV/HERV-W. [20] The alignment of P815 and P91A is:

gi|2137840|pir||I49504     SAPLLPEVEAYLQLLMVIFLMNSKRYKEAQKISDDLMQKISTQNHRALDL 200
gi|285053|pir||PC1154      ----------------------------AQKISDDLMQKISTQNRRALDL 22
                                                       ****************:*****

gi|2137840|pir||I49504     VAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLL 250
gi|285053|pir||PC1154      VAAKCYYYHARVYEFLDKLDVVR--------------------------- 45
                           *********************** 


Data suggest SZRV/HERV-W envelope, in the identified area, is likely capable of dysregulation of glucose signaling; that it similar to P815A and P91A; that it is similar to Syntaxin-17 or a not-yet-characterized syntaxin in its overall design; that it is similar to tSNAREs generally, that it is a serine-threonine receptor-like protein; and, that it phosphorylates in the identified area.

Just as it is the case that proteins which closely resemble T-cell receptors (but are not T-cell receptors) are considered superantigens it is consistent to consider the identified region of SZRV/HERV-W envelope, patterning a serine-threonine receptor, is, itself, very like a superantigen capable of either direct or indirect dysregulation of important glutamate signaling. This would suggest a new or variant type of superantigen - a mimick capable of dysregulation of its normally structured and appropriately functioning protein - which is not a T-cell receptor mimick, but is a mimic of another important metabolic receptor. Evidence exists (above) to indicate this region of SZRV/HERV-W envelope may function as a putative superantigen-like protein capable of causing either direct or indirect metabolic dysregulation that has been observed by others associated with schizophrenia. There is the suggestion that syntaxin-17 or a new-as-yet-uncharacterized syntaxin-17-like protein is involved in some schizophrenias and these may interfere with G6PD activity. There is the suggestion in the data that this protein is immunologically active and is related to various tumor antigens and that there is a likelihood of a graft-vs-host (self vs non-self) immunogenicity occurring as a result of SZRV/HERV-W attaching itself, via it's p15e spike, to cell surfaces.

Consider this alignment:

gi|13310191|gb|AAK18189.1|AF33     TGIGS---ITTSTQFYYKLSQEINGDMEQVTDSLVTLQDQLNSLAAVVLQ 381
gi|6857789|ref|NP_034375.1|        ARVGTGTTALVATQQFQQLQAAMHNDLKAVEESITNLERSLTSLSEVVLQ 548
                                   : :*:     .:** : :*.  ::.*:: * :*:..*: .*.**: ****

gi|13310191|gb|AAK18189.1|AF33     NRRALDLLTAKRGGTCLFLGEERCYYVNQSRIVTEKVKEIRDRIQCRAEE 431
gi|6857789|ref|NP_034375.1|        NRRGLDLLFLKEGGLCAALKEECCFYADHTGLVRDSMAKLRERLNQRQKL 598
                                   ***.****  *.** *  * ** *:*.::: :* :.: ::*:*:: * : 


Accession NP_034375.1, immediately above, is Friend murine leukemia susceptibility factor 4. Notice the substantial relationship in the identified region of SZRV/HERV-W identified region.

And consider this alignment:

gi|34328177|ref|NP_034279.2|     ILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESDFEGLFTTHK 300
gi|1827626|pdb|1MOF|             LTSLSEV------------VLQNRR--------GL-------DLLFLKEG 40
                                 : :** :            :*.:**        *:       : ** .. 


Accession No. 1MOF is p15e from Moloney Murine Leukemia Virus; Accession No. NP_034279.2 is erythropoietin receptor [Mus musculus]. When the above two are aligned with SZRV/HERV-W identified region, the following alignment is generated:

gi|1827626|pdb|1MOF|                ----MDDLREVEKSIS--NLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCA 44
gi|13310191|gb|AAK18189.1|AF33      SQEINGDMEQVTDSLV--TLQDQLNSLAAVVLQNRRALDLLTAKRGGTCL 398
gi|34328177|ref|NP_034279.2|        GDPGADDEGPLLEPVGSEHAQDTYLVLDKWLLPRTPCSENLSGPGGSVDP 393
                                         .*   : ..:     :.    *   :* .    : *    *.  


Notice the apparent motif present in the above alignment that is highlighted in red. The motif provides further evidence that the identified sequence of SZRV/HERV-W appears to be mimicking a receptor. Consider, also this alignment:

gi|45383091|ref|NP_989875.1|       LNISATLEIVENATTDALRAIQEEVSSLSKVVLQNRMALDLLTAKEGGVC 320
gi|13310191|gb|AAK18189.1|AF33     YKLSQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTC 397
                                    ::*  ::   : .**:* ::*:::.**: ****** ********.**.*


Accession No. NP_989875.1, above, is FET-1, a novel W-linked, female-specific gene up-regulated in the embryonic chicken ovary. Reed and Sinclair (2002) stated "FET-1 expression was restricted to females and up-regulated in the cortex of the left gonad during the sex-determining period. Female specific expression was also observed in the embryonic caudal somites, neural tube and waste collection ducts." [21] Another alignment appears to shows the motif:

gi|45709006|gb|AAH67526.1|         FSATKQTLEAHQSKVSSLASASRKD-HVLDIPTTQRQTACGTVGKQCCLY 447
gi|45709472|gb|AAH67527.1|         FSATKQTLEAHQSKVSSLASASRKD-HVLDIPTTQRQTACGTVGKQCCLY 289
gi|37779146|gb|AAO86732.1|         FSATKQTLEAHQSKVSSLASASRKD-HVLDIPTTQRQTACGTVGKQCCLY 447
gi|10434327|dbj|BAB14220.1|        FSATKQTLEAHQSKVSSLASASRKD-HVLDIPTTQRQTACGTVGKQCCLY 447
gi|45709855|gb|AAH67528.1|         FSATKQTLEAHQSKVSSLASASRKD-HVLDIPTTQRQTACGTVGKQCCLY 447
gi|45383091|ref|NP_989875.1|       ENATTDALRAIQEEVSSLSKVVLQNRMALDLLTAKEGGVCTIINQSCCAY 330
gi|13310191|gb|AAK18189.1|AF33     MEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGTCLFLGEERCYY 407
                                    . ..::* : *.::.**: .  ::  .**: *::.  .*  :.:. * *


The above alignment shows a human protein, FLJ12684, e.g., Accession No. AAH67528.1, in alignment with SZRV/HERV-W and FET-1. FLJ12684 is a putative ORF located at chromosome: 4; Location: 4q12. As can be seen above, the identified region of SZRV/HERV-W is rather more similar to FET-1, but a motif seems to present itself in all of the above proteins.

Consider this alignment:

gi|30354610|gb|AAH51790.1|          ------------------------VKEEASAATAEFLQ------------ 107
gi|13310191|gb|AAK18189.1|AF33      TQFYYKLSQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKR 393
gi|45383091|ref|NP_989875.1|        EKAILNISATLEIVENATTDALRAIQEEVSSLSKVVLQNRMALDLLTAKE 316
                                                            :::: .: :  .** 


The above alignment of SZRV/HERV-W p15e identified region, FET-1, and Human Syntaxin-17 show much commonlity but with the P815a tum portion absent in the alignment. The portion of Human Syntaxin-17 that is not shown in the above alignment (as it does not align here) and which appears where the P815a tum portion exists in the alignment above is LHLESVEELKK but suggests itself to be related in function to NRRALDLLTAK. It is as if there is half of the identified region present in Human Syntaxin-17; moreover, FET-1 seems to be a combination of syntaxin and SZRV/HERV-W in this particular region. Interestingly, though not shown, this region also appears related to squamous cell carcinoma antigen (SCCA1/SCCA2 fusion protein) and serine protease inhibitors.

The motif seems to be, expectedly, consistent with the Type-C and Type-D leukemia viruses in many species.

Consider this alignment:

gi|334388|gb|AAA47563.1|            YTKLSRQLISDVQAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
gi|40018526|ref|NP_954563.1|        YTKLSHQLISDVQAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
gi|61508|emb|CAA29028.1|            YTKLSNQLISDVQILSSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
gi|61677|emb|CAA36196.1|            YTKLSHQLISDVQVLSGTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
gi|576642|gb|AAC54042.1|            YTKLSNQLISDIQTLSSTIQDLQDQVDSLAKVVLQNRRGLDLLTAEQGGI
gi|11055586|gb|AAG28161.1|          YAKLSNQLINDVQTLSGTIHDLQDQIDSLAEVVLQNRRGLDLLTAEQGGI
gi|61786|emb|CAA25686.1|            YHKLSNQLIEDVQALSGTINDLQDQIDSLAEVVLQNRRGLDLLTAEQGGI
gi|28927670|gb|AAF81698.2|          YHKLSNQLIEDVQALSGTINDLQDQIDSLAEVVLQNRRGLDLLTAEQGGI
gi|33411093|gb|AAQ17603.1|          YYKLSQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGT
gi|20978308|gb|AAM33413.1|          YYKLSQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGT
gi|48949851|ref|NP_055405.3|        YYKLSQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGT
gi|13310191|gb|AAK18189.1|          YYKLSQEINGDMEQVTDSLVTLQDQLNSLAAVVLQNRRALDLLTAKRGGT
gi|45383091|ref|NP_989875.1|        ILNISATLEIVENATTDALRAIQEEVSSLSKVVLQNRMALDLLTAKEGGV
                                      ::*  :    :  :.::  :*:::.**: ****** .******:.** 


Above is shown the remarkable similarity of FET-1 to the SZRV/HERV-W and some of its apparent relatives, e.g., RD-114 or SRV-2, in the identified area. The alignment, below, suggests some similarity of the identified area with solute carrier family 2 (facilitated glucose transporter), member 4 from Mus musculus:

gi|13310191|gb|AAK18189.1|AF33      ----------------------SLAAVVLQNRRALDLLTAK---------
gi|1827626|pdb|1MOF|_Coat_Prot      ----------------------SLSEVVLQNRRGLDLLFLK---------
gi|6678015|ref|NP_033230.1|_so      ----------------VVNTVFTLVSVLLVERAGRRTLHLLG--------


Accession No. NP_033230.1 is a glucose transporter and resembles GLUT4. McDermott and de Silva (2005) presented evidence to suggest:
"Reduced glucose uptake will disrupt production of glutamate - functionally similar to the schizophrenia-like syndrome produced by PCP, a glutamate antagonist. In the longer term, reduced neuronal growth and poor synaptic contacts will produce chronic cognitive difficulties and perpetuate acute symptoms. A backlog effect due to reduced brain uptake of glucose would produce systemic hyperglycaemia observed in drug naive subjects. Rat studies have shown that clozapine and similar compounds block GLUT proteins in the brain and peripherally, more so than selective dopamine blockers. By blocking GLUT proteins, clozapine would break malfunctioning circuits, resulting in the disappearance of cognitive and perceptual symptoms. Unfortunately, these drugs would also raise systemic glucose levels, increasing the risk of diabetes, as observed in longer term studies of clozapine in particular. We summarise potentially useful research strategies, including studying the genotype of GLUT proteins with respect to schizophrenia phenotypes, activation studies involving fMRI using deoxyglucose as a substrate, and investigating clinical features of schizophrenic patients prior to and following treatment for co-existing diabetes." [22]

Langosch et al. (2001) reported that peptide mimics of SNARE trans-membrane segments can, depending on their conformational plasticity, drive membrane fusion. [23] They also reported:
"Structural studies of the peptides in lipid bilayers performed by Fourier transform infrared spectroscopy indicated mixtures of alpha-helical and beta-sheet conformations. In isotropic solution, circular dichroism spectroscopy showed the peptides to exist in a concentration-dependent equilibrium of alpha-helical and beta-sheet structures. Interestingly, the fusogenic activity decreased with increasing stability of the alpha-helical solution structure for a panel of variant peptides." [24]

T-cell receptor activity is also associated with alpha-helical and beta-sheet structures and superantigens mimic T-cell alpha-beta structure. There is clearly the suggestion that the t-SNARE which appears to be present in SZRV/HERV-W, and somewhat resembling syntaxin-17, at:

LQDQNSLAAVVLQNRRALDLL

having a helical structure, being somewhat hydrophobic, seemingly related to v-RAS, with a likely N-terminal myristoylation site, and phosphorylation area, and resembling, in part, tumor antigens, could produce a graft-vs-host reaction. Some schizophrenias may, significantly, therefore, be, in fact, acquired autoimmune disorders and may be a result of either vertical or horizontal transmission.

Given that SZRV/HERV-W envelope appears to resemble some Type-C and Type-D leukemia viruses it is possible that there may be value in determining why some individuals develop schizophrenia and not leukemia or sarcoma when infected with SZRV/HERV-W. Perhaps there is some mechanism in some schizophrenias or in their causative retroviruses or retroposons that, if discerned, could be applied to treatment of leukemias and sarcomas. Perhaps this possible protective mechanism in some schizophrenias is related to glucose transport and/or glutamate metabolism genetics. Manel, Battini, and Sitbon (2005) reported Human T cell leukemia virus (HTLV-I) envelope binding and virus entry are mediated by distinct domains of the glucose transporter GLUT1. [25] SZRV/HERV-W is a relative of HTLV-I and, data suggest, is also likely to have this envelope binding and virus entry mediated by distinct domains of glucose transporter; perhaps, as the above data appear to suggest, GLUT4 and a syntaxin-17-like t-SNARE.

Taken all together, evidence presented here suggests it is prudent to further examine SZRV/HERV-W envelope in the identified region, LQDQNSLAAVVLQNRRALDLL, and the short regions immediately before and immediately after this potential superantigen-like, serine-threonine receptor-like, syntaxin-17-like p15e envelope spike protein. Such examination may likely produce useful information in understanding the precise mechanism of how SZRV/HERV-W can likely cause schizophrenia via glucose-and-subsequent-glutamate dysregulation in some individuals and may open a line of investigation on new superantigen-like syntaxin-like proteins which are capable of disturbing metabolic and immunogenic processes involved in effective thought processes and may cause serious psychiatric disorders. Additionally, pursuit of this examination may also lead to refined understanding of the relationship of glucose and glutamate interactions that may help to reveal mechanations of some leukemias, sarcomas, and immunodeficiency disorders.



Robert E. Lee, M.S., M.S.W., L.C.S.W., Ph.D.
October 23, 2005



References:

[1] Watson RT, Pessin JE. Transmembrane domain length determines intracellular membrane compartment localization of syntaxins 3, 4, and 5. Am J Physiol Cell Physiol. 2001 Jul;281(1):C215-23. PMID: 11401844

[2] Dascher C, Matteson J, Balch WE. Syntaxin 5 regulates endoplasmic reticulum to Golgi transport. J Biol Chem. 1994 Nov 25;269(47):29363-6. PMID: 7961911

[3] Loh E, Hong W. Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp. J Biol Chem. 2002 Jun 14;277(24):21955-61. Epub 2002 Apr 2. PMID: 11929878

[4] Nichols BJ, Pelham HR. SNAREs and membrane fusion in the Golgi apparatus. Biochim Biophys Acta. 1998 Aug 14;1404(1-2):9-31. Review. PMID: 9714710

[5] Xu D, Joglekar AP, Williams AL, Hay JC. Subunit structure of a mammalian ER/Golgi SNARE complex. J Biol Chem. 2000 Dec 15;275(50):39631-9. PMID: 11035026

[6] Steegmaier M, Oorschot V, Klumperman J, Scheller RH. Syntaxin-17 is abundant in steroidogenic cells and implicated in smooth endoplasmic reticulum membrane dynamics. Mol Biol Cell. 2000 Aug;11(8):2719-31. PMID: 10930465

[7] Zhang Q, Li J, Deavers M, Abbruzzese JL, Ho L. The Subcellular Localization of Syntaxin-17 Varies among Different Cell Types and Is Altered in some Malignant Cells. J Histochem Cytochem. 2005 Jun 13; [Epub ahead of print] PMID: 15956034

[8] Honer WG, Falkai P, Bayer TA, Xie J, Hu L, Li HY, Arango V, Mann JJ, Dwork AJ, Trimble WS. Abnormalities of SNARE mechanism proteins in anterior frontal cortex in severe mental illness. Cereb Cortex. 2002 Apr;12(4):349-56. PMID: 11884350

[9] Wong AH, Trakalo J, Likhodi O, Yusuf M, Macedo A, Azevedo MH, Klempan T, Pato MT, Honer WG, Pato CN, Van Tol HH, Kennedy JL. Association between schizophrenia and the syntaxin 1A gene. Biol Psychiatry. 2004 Jul 1;56(1):24-9. PMID: 15219469

[10] Steegmaier M, Oorschot V, Klumperman J, Scheller RH. Syntaxin-17 is abundant in steroidogenic cells and implicated in smooth endoplasmic reticulum membrane dynamics. Mol Biol Cell. 2000 Aug;11(8):2719-31. PMID: 10930465

[11] Deb-Rinker P, Klempan TA, O'Reilly RL, Torrey EF, Singh SM. Molecular characterization of a MSRV-like sequence identified by RDA from monozygotic twin pairs discordant for schizophrenia. Genomics. 1999 Oct 15;61(2):133-44. PMID: 10534399

[12] Camardella L, Carratore V, Ciardiello MA, Damonte G, Benatti U, De Flora A. Primary structure of human erythrocyte nicotinamide adenine dinucleotide phosphate (NADP[H])-binding protein FX: identification with the mouse tum- transplantation antigen P35B. Blood. 1995 Jan 1;85(1):264-7. PMID: 7803801

[13] Bared SM, Buechler C, Boettcher A, Dayoub R, Sigruener A, Grandl M, Rudolph C, Dada A, Schmitz G. Association of ABCA1 with syntaxin 13 and flotillin-1 and enhanced phagocytosis in tangier cells. Mol Biol Cell. 2004 Dec;15(12):5399-407. Epub 2004 Oct 6. PMID: 15469992

[14] Siddiqi SA, Gorelick FS, Mahan JT, Mansbach CM 2nd. COPII proteins are required for Golgi fusion but not for endoplasmic reticulum budding of the pre-chylomicron transport vesicle. J Cell Sci. 2003 Jan 15;116(Pt 2):415-27. PMID: 12482926

[15] Park SY, Kim CH, Jeong WH, Lee JH, Seo SJ, Han YS, Lee IH. Effects of two hemolymph proteins on humoral defense reactions in the wax moth, Galleria mellonella. Dev Comp Immunol. 2005;29(1):43-51. PMID: 15325522

[16] Ji C, Wang Y, Guo X, Hartson S, Jiang H. A pattern recognition serine proteinase triggers the prophenoloxidase activation cascade in the tobacco hornworm, Manduca sexta. J Biol Chem. 2004 Aug 13;279(33):34101-6. Epub 2004 Jun 9. PMID: 15190055

[17] Lai CY, Cheng W, Kuo CM. Molecular cloning and characterisation of prophenoloxidase from haemocytes of the white shrimp, Litopenaeus vannamei. Fish Shellfish Immunol. 2005 May;18(5):417-30. Epub 2005 Jan 25. PMID: 15683918

[18] Tonetti M, Sturla L, Bisso A, Benatti U, De Flora A. Synthesis of GDP-L-fucose by the human FX protein. J Biol Chem. 1996 Nov 1;271(44):27274-9. PMID: 8910301

[19] Bocchetta A. Psychotic mania in glucose-6-phosphate-dehydrogenase-deficient subjects. Ann Gen Hosp Psychiatry. 2003 Jun 13;2(1):6. PMID: 12844366

[20] McCormick D, Stauss HJ, Thorpe C, Travers P, Dyson PJ. Major histocompatibility complex and T cell receptor interaction of the P91A tum- peptide. Eur J Immunol. 1996 Dec;26(12):2895-902. PMID: 8977283

[21] Reed KJ, Sinclair AH. FET-1: a novel W-linked, female specific gene up-regulated in the embryonic chicken ovary. Gene Expr Patterns. 2002 Nov;2(1-2):83-6. PMID: 12617842

[22] McDermott E, de Silva P. Impaired neuronal glucose uptake in pathogenesis of schizophrenia - Can GLUT 1 and GLUT 3 deficits explain imaging, post-mortem and pharmacological findings? Med Hypotheses. 2005;65(6):1076-81. Epub 2005 Aug 25. PMID: 16125330

[23] Langosch D, Crane JM, Brosig B, Hellwig A, Tamm LK, Reed J. Peptide mimics of SNARE transmembrane segments drive membrane fusion depending on their conformational plasticity. J Mol Biol. 2001 Aug 24;311(4):709-21. PMID: 11518525

[24] Langosch D, Crane JM, Brosig B, Hellwig A, Tamm LK, Reed J. Peptide mimics of SNARE transmembrane segments drive membrane fusion depending on their conformational plasticity. J Mol Biol. 2001 Aug 24;311(4):709-21. PMID: 11518525

[25] Manel N, Battini JL, Sitbon M. Human T cell leukemia virus envelope binding and virus entry are mediated by distinct domains of the glucose transporter GLUT1. J Biol Chem. 2005 Aug 12;280(32):29025-9. Epub 2005 Jun 13. PMID: 15955807


Keywords
schizophrenia
syntaxin-17
FET-1
fusion proteins
psychoneuro-superantigens
Type D retrovirus
Type C retrovirus

Acknowledgements
Kind acknowledgements to Dr. Alan Cantwell, Dr. Trevor Marshall, Dr. Brian T. Foley for their teaching.


Competing Interests
None declared.



Post Edited (12-02-05 20:35)

 
 Re: SNARES, Antigens, Retroviruses, Superantigens, and Schizophrenia
Author: Admin (---.ventca.adelphia.net)
Date:   10-26-05 19:29


Editorial

JOIMR is pleased to publish this paper from Dr. Lee.

In these days when so much research is focused purely on Drug Discovery, it is gratifying when a paper arrives which reflects an attempt to understand disease processes - to use the very best of the genomic tools in the wholely academic endeavor of understanding.

Dr Lee has managed to 'fill in the blanks' and describe some putative links between 'neurological' and 'autoimmune' processes.

Even though my own work (http://dx.doi.org/10.1016/j.autrev.2003.10.001) has called into question the entire concept of 'autoimmunity,' I found it fascinating to work through Dr. Lee's paper. And that is the fundamental purpose of scientific publication - the proliferation of novel concepts and cross-fertilization between research programs.

Your considered peer-reviews will be welcomed.

Sincerely,
Trevor G Marshall, PhD
Managing Editor, JOIMR.org
Autoimmunity Research Foundation

 Go back to Main Menu    



Warning: main(./login.php) [function.main]: failed to open stream: No such file or directory in /home/joimrorg/public_html/phorum/include/form.php on line 10

Warning: main(./login.php) [function.main]: failed to open stream: No such file or directory in /home/joimrorg/public_html/phorum/include/form.php on line 10

Warning: main(./login.php) [function.main]: failed to open stream: No such file or directory in /home/joimrorg/public_html/phorum/include/form.php on line 10

Warning: main() [function.include]: Failed opening './login.php' for inclusion (include_path='/usr/lib/php:.:/usr/local/php4/lib/php') in /home/joimrorg/public_html/phorum/include/form.php on line 10

Want to learn how to make your papers look better, with bold text and embedded images? Here is the info...

All webpages, layout and style are (C)Copyright 2003-2005, JOIMR.ORG
Papers belong to the Persons who posted them: (C)Copyright 2003, as Attributed (read policy)
There is no expectation of Privacy for any material posted on this site. See our Privacy Policy.
All rights reserved. Click to email webmaster. Powered by Phorum, Apache, MySQL, and Linux